PDB entry 3sd6

View 3sd6 on RCSB PDB site
Description: Crystal structure of the amino-terminal domain of human cardiac troponin C in complex with cadmium at 1.4 resolution.
Class: contractile protein
Keywords: helix-loop-helix ef-hand motif, contractile protein, calcium sensor, cadmium binding
Deposited on 2011-06-08, released 2012-06-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: 0.134
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: troponin c, slow skeletal and cardiac muscles
  Species: Homo sapiens [TaxId:9606]
  Gene: TNNC, TNNC1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63316 (0-88)
  Domains in SCOPe 2.06: d3sd6a_
• Heterogens: CD, ACT, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3sd6A (A:)
  mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
  idevdedgsgtvdfdeflvmmvrcmkdds
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3sd6A (A:)
  mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
  idevdegtvdfdeflvmmvrcmkdds