PDB entry 3sd6

View 3sd6 on RCSB PDB site
Description: Crystal structure of the amino-terminal domain of human cardiac troponin C in complex with cadmium at 1.4 resolution.
Class: contractile protein
Keywords: helix-loop-helix ef-hand motif, contractile protein, calcium sensor, cadmium binding
Deposited on 2011-06-08, released 2012-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNC, TNNC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sd6a_
  • Heterogens: CD, ACT, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sd6A (A:)
    mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrcmkdds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sd6A (A:)
    mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
    idevdegtvdfdeflvmmvrcmkdds