PDB entry 3scg

View 3scg on RCSB PDB site
Description: Fe(II)-HppE with R-HPP
Class: metal binding protein
Keywords: cupin-fold, Hydroxypropylphosphonic acid epoxidase, mononuclear non-heme iron ENZYME, METAL BINDING PROTEIN
Deposited on 2011-06-07, released 2011-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.217
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epoxidase
    Species: STREPTOMYCES WEDMORENSIS [TaxId:43759]
    Gene: fom4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3scga1, d3scga2
  • Chain 'B':
    Compound: epoxidase
    Species: STREPTOMYCES WEDMORENSIS [TaxId:43759]
    Gene: fom4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3scgb1, d3scgb2
  • Chain 'C':
    Compound: epoxidase
    Species: STREPTOMYCES WEDMORENSIS [TaxId:43759]
    Gene: fom4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3scgc1, d3scgc2
  • Heterogens: TB6, FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3scgA (A:)
    msntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgria
    hvlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvpl
    vvdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvph
    aftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3scgA (A:)
    tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
    sigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvl
    tdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaa
    kgtgsakliavnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3scgB (B:)
    msntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgria
    hvlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvpl
    vvdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvph
    aftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3scgB (B:)
    tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
    sigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvl
    tdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaa
    kgtgsakliavnf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3scgC (C:)
    msntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgria
    hvlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvpl
    vvdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvph
    aftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3scgC (C:)
    tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
    sigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvl
    tdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaa
    kgtgsakliavnf