PDB entry 3sbx

View 3sbx on RCSB PDB site
Description: Crystal structure of a putative uncharacterized protein from Mycobacterium marinum bound to adenosine 5'-monophosphate AMP
Class: Unknown Function
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, putative uncharacterized protein, Molybdenum cofactor binding protein, Moco, GTP, orthologs are possible misannotated as possible or putative lysine decarboxylases, AMP was MS verified, proteomics, Unknown Function
Deposited on 2011-06-06, released 2011-06-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Mycobacterium marinum M [TaxId:216594]
    Gene: MMAR_4233
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3sbxa_
  • Chain 'B':
    Compound: Putative uncharacterized protein
    Species: Mycobacterium marinum M [TaxId:216594]
    Gene: MMAR_4233
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3sbxb_
  • Chain 'C':
    Compound: Putative uncharacterized protein
    Species: Mycobacterium marinum M [TaxId:216594]
    Gene: MMAR_4233
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3sbxc_
  • Chain 'D':
    Compound: Putative uncharacterized protein
    Species: Mycobacterium marinum M [TaxId:216594]
    Gene: MMAR_4233
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3sbxd_
  • Chain 'E':
    Compound: Putative uncharacterized protein
    Species: Mycobacterium marinum M [TaxId:216594]
    Gene: MMAR_4233
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3sbxe_
  • Chain 'F':
    Compound: Putative uncharacterized protein
    Species: Mycobacterium marinum M [TaxId:216594]
    Gene: MMAR_4233
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3sbxf_
  • Chain 'G':
    Compound: Putative uncharacterized protein
    Species: Mycobacterium marinum M [TaxId:216594]
    Gene: MMAR_4233
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3sbxg_
  • Chain 'H':
    Compound: Putative uncharacterized protein
    Species: Mycobacterium marinum M [TaxId:216594]
    Gene: MMAR_4233
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3sbxh_
  • Heterogens: AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sbxA (A:)
    gpgstaksdepgrwtvavycaaapthpellelagavgaaiaargwtlvwggghvsamgav
    ssaarahggwtvgvipkmlvhreladhdadelvvtetmwerkqvmedranafitlpggvg
    tldelldvwtegylgmhdksivvldpwghfdglrawlseladtgyvsrtamerlivvdnl
    ddalqacap
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sbxA (A:)
    rwtvavycaaapthpellelagavgaaiaargwtlvwggghvsamgavssaarahggwtv
    gvipkmlvhreladhdadelvvtetmwerkqvmedranafitlpggvgtldelldvwteg
    ylgmhdksivvldpwghfdglrawlseladtgyvsrtamerlivvdnlddalqacap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sbxB (B:)
    gpgstaksdepgrwtvavycaaapthpellelagavgaaiaargwtlvwggghvsamgav
    ssaarahggwtvgvipkmlvhreladhdadelvvtetmwerkqvmedranafitlpggvg
    tldelldvwtegylgmhdksivvldpwghfdglrawlseladtgyvsrtamerlivvdnl
    ddalqacap
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sbxB (B:)
    rwtvavycaaapthpellelagavgaaiaargwtlvwggghvsamgavssaarahggwtv
    gvipkmlvhreladhdadelvvtetmwerkqvmedranafitlpggvgtldelldvwteg
    ylgmhdksivvldpwghfdglrawlseladtgyvsrtamerlivvdnlddalqacap
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3sbxC (C:)
    gpgstaksdepgrwtvavycaaapthpellelagavgaaiaargwtlvwggghvsamgav
    ssaarahggwtvgvipkmlvhreladhdadelvvtetmwerkqvmedranafitlpggvg
    tldelldvwtegylgmhdksivvldpwghfdglrawlseladtgyvsrtamerlivvdnl
    ddalqacap
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sbxC (C:)
    rwtvavycaaapthpellelagavgaaiaargwtlvwggghvsamgavssaarahggwtv
    gvipkmlvhreladhdadelvvtetmwerkqvmedranafitlpggvgtldelldvwteg
    ylgmhdksivvldpwghfdglrawlseladtgyvsrtamerlivvdnlddalqacap
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3sbxD (D:)
    gpgstaksdepgrwtvavycaaapthpellelagavgaaiaargwtlvwggghvsamgav
    ssaarahggwtvgvipkmlvhreladhdadelvvtetmwerkqvmedranafitlpggvg
    tldelldvwtegylgmhdksivvldpwghfdglrawlseladtgyvsrtamerlivvdnl
    ddalqacap
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sbxD (D:)
    rwtvavycaaapthpellelagavgaaiaargwtlvwggghvsamgavssaarahggwtv
    gvipkmlvhreladhdadelvvtetmwerkqvmedranafitlpggvgtldelldvwteg
    ylgmhdksivvldpwghfdglrawlseladtgyvsrtamerlivvdnlddalqacap
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3sbxE (E:)
    gpgstaksdepgrwtvavycaaapthpellelagavgaaiaargwtlvwggghvsamgav
    ssaarahggwtvgvipkmlvhreladhdadelvvtetmwerkqvmedranafitlpggvg
    tldelldvwtegylgmhdksivvldpwghfdglrawlseladtgyvsrtamerlivvdnl
    ddalqacap
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sbxE (E:)
    rwtvavycaaapthpellelagavgaaiaargwtlvwggghvsamgavssaarahggwtv
    gvipkmlvhreladhdadelvvtetmwerkqvmedranafitlpggvgtldelldvwteg
    ylgmhdksivvldpwghfdglrawlseladtgyvsrtamerlivvdnlddalqacap
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3sbxF (F:)
    gpgstaksdepgrwtvavycaaapthpellelagavgaaiaargwtlvwggghvsamgav
    ssaarahggwtvgvipkmlvhreladhdadelvvtetmwerkqvmedranafitlpggvg
    tldelldvwtegylgmhdksivvldpwghfdglrawlseladtgyvsrtamerlivvdnl
    ddalqacap
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sbxF (F:)
    rwtvavycaaapthpellelagavgaaiaargwtlvwggghvsamgavssaarahggwtv
    gvipkmlvhreladhdadelvvtetmwerkqvmedranafitlpggvgtldelldvwteg
    ylgmhdksivvldpwghfdglrawlseladtgyvsrtamerlivvdnlddalqacap
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3sbxG (G:)
    gpgstaksdepgrwtvavycaaapthpellelagavgaaiaargwtlvwggghvsamgav
    ssaarahggwtvgvipkmlvhreladhdadelvvtetmwerkqvmedranafitlpggvg
    tldelldvwtegylgmhdksivvldpwghfdglrawlseladtgyvsrtamerlivvdnl
    ddalqacap
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sbxG (G:)
    rwtvavycaaapthpellelagavgaaiaargwtlvwggghvsamgavssaarahggwtv
    gvipkmlvhreladhdadelvvtetmwerkqvmedranafitlpggvgtldelldvwteg
    ylgmhdksivvldpwghfdglrawlseladtgyvsrtamerlivvdnlddalqacap
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3sbxH (H:)
    gpgstaksdepgrwtvavycaaapthpellelagavgaaiaargwtlvwggghvsamgav
    ssaarahggwtvgvipkmlvhreladhdadelvvtetmwerkqvmedranafitlpggvg
    tldelldvwtegylgmhdksivvldpwghfdglrawlseladtgyvsrtamerlivvdnl
    ddalqacap
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sbxH (H:)
    rwtvavycaaapthpellelagavgaaiaargwtlvwggghvsamgavssaarahggwtv
    gvipkmlvhreladhdadelvvtetmwerkqvmedranafitlpggvgtldelldvwteg
    ylgmhdksivvldpwghfdglrawlseladtgyvsrtamerlivvdnlddalqacap