PDB entry 3sbk

View 3sbk on RCSB PDB site
Description: Russell's viper venom serine proteinase, RVV-V (PPACK-bound form)
Class: hydrolase/hydrolase inhibitor
Keywords: serine proteinase, glycosylation, double six-stranded beta-barrels, Hydrolase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-06-05, released 2011-09-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.25
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vipera russelli proteinase RVV-V gamma
    Species: Daboia russellii siamensis [TaxId:343250]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3sbka_
  • Heterogens: NAG, 0G6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sbkA (A:)
    vvggdecninehpflvalytsasstihcagalinrewvltaahcdrrniriklgmhskni
    rnedeqirvprgkyfclntkfpngldkdimlirlrrpvtysthiapvslpsrsrgvgsrc
    rimgwgkistttypdvphctnifivkhkwceplypwvpadsrtlcagilkggrdtchgds
    ggplicngemhgivaggsepcgqhlkpavytkvfdynnwiqsiiagnrtvtcpp