PDB entry 3sb0

View 3sb0 on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis malate synthase in complex with 4-(2-chloro-6-fluoro-3-methylphenyl)-2,4-dioxobutanoic acid inhibitor
Class: transferase/transferase inhibitor
Keywords: inhibitor complex, Structural Genomics, Mycobacterium Tuberculosis Structural Proteomics Project, XMTB, malate synthase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-06-03, released 2012-11-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate synthase g
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glcB, GlcB (Rv1837c), MT1885, MTCY1A11.06, Rv1837c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5J4
      • engineered mutation (618)
    Domains in SCOPe 2.08: d3sb0a_
  • Heterogens: MG, I93, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sb0A (A:)
    mtdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardel
    qaqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvp
    vlnarfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsv
    plssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhie
    ilidpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdla
    aavdkdgtaflrvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfe
    gimdalftgliaihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvl
    glpqntmkigimdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrk
    gtmksqpwilayedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragasta
    wvpsptaatlhalhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdn
    ncqsilgyvvrwvdqgvgaskvpdihdvalmedratlrissqllanwlrhgvitsadvra
    slermaplvdrqnagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrre
    fkaraaekpapsdragddaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sb0A (A:)
    tdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelq
    aqidkwhrrridmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpvlnar
    falnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsvplssg
    sfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhieilidp
    esqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaarvln
    rdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfegimdalftgliaihg
    lkasdlinsrtgsiyivkpkmhgpaevaftcelfsrvedvlglpqntmkigimdeerrtt
    vnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkgtmksqpwilayedhnvda
    glaagfsgraqvgkgmwtmtelmadmvetkiaqpragastawvpsptaatlhalhyhqvd
    vaavqqglagkrratieqlltiplakelawapdeireevdnncqsilgyvvrwvdqgvga
    skvpdihdvalmedratlrissqllanwlrhgvitsadvraslermaplvdrqnagdvay
    rpmapnfddsiaflaaqelilsgaqqpngytepilhrrrrefkaraae