PDB entry 3sal

View 3sal on RCSB PDB site
Description: Crystal Structure of Influenza A Virus Neuraminidase N5
Class: hydrolase
Keywords: 6-bladed beta-propeller, hydrolase, calcium binding, glycosylation
Deposited on 2011-06-03, released 2011-08-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.128
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:385582]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3sala_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:385582]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3salb_
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3salA (A:)
    peflnnteplcnvsgfaivskdngirigsrghvfvirepfvacgptecrtffltqgalln
    dkhsnntvkdrspyralmsvplgsspnayqakfesvawsatachdgkkwlavgisgaddd
    ayavihyggmptdvvrswrkqilrtqesscvcmngncywvmtdgpansqasykifksheg
    mvtnerevsfqgghieecscypnlgkvecvcrdnwngmnrpilifdedldyevgylcagi
    ptdtprvqdssftgsctnavggsgtnnygvkgfgfrqgnsvwagrtvsissrsgfeilli
    edgwirtsktivkkvevlnnknwsgysgaftipitmtskqclvpcfwlemirgkpeerts
    iwtsssstvfcgvssevpgwswddgailpfdidkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3salA (A:)
    peflnnteplcnvsgfaivskdngirigsrghvfvirepfvacgptecrtffltqgalln
    dkhsnntvkdrspyralmsvplgsspnayqakfesvawsatachdgkkwlavgisgaddd
    ayavihyggmptdvvrswrkqilrtqesscvcmngncywvmtdgpansqasykifksheg
    mvtnerevsfqgghieecscypnlgkvecvcrdnwngmnrpilifdedldyevgylcagi
    ptdtprvqdssftgsctnavggsgtnnygvkgfgfrqgnsvwagrtvsissrsgfeilli
    edgwirtsktivkkvevlnnknwsgysgaftipitmtskqclvpcfwlemirgkpeerts
    iwtsssstvfcgvssevpgwswddgailpfdidk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3salB (B:)
    peflnnteplcnvsgfaivskdngirigsrghvfvirepfvacgptecrtffltqgalln
    dkhsnntvkdrspyralmsvplgsspnayqakfesvawsatachdgkkwlavgisgaddd
    ayavihyggmptdvvrswrkqilrtqesscvcmngncywvmtdgpansqasykifksheg
    mvtnerevsfqgghieecscypnlgkvecvcrdnwngmnrpilifdedldyevgylcagi
    ptdtprvqdssftgsctnavggsgtnnygvkgfgfrqgnsvwagrtvsissrsgfeilli
    edgwirtsktivkkvevlnnknwsgysgaftipitmtskqclvpcfwlemirgkpeerts
    iwtsssstvfcgvssevpgwswddgailpfdidkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3salB (B:)
    peflnnteplcnvsgfaivskdngirigsrghvfvirepfvacgptecrtffltqgalln
    dkhsnntvkdrspyralmsvplgsspnayqakfesvawsatachdgkkwlavgisgaddd
    ayavihyggmptdvvrswrkqilrtqesscvcmngncywvmtdgpansqasykifksheg
    mvtnerevsfqgghieecscypnlgkvecvcrdnwngmnrpilifdedldyevgylcagi
    ptdtprvqdssftgsctnavggsgtnnygvkgfgfrqgnsvwagrtvsissrsgfeilli
    edgwirtsktivkkvevlnnknwsgysgaftipitmtskqclvpcfwlemirgkpeerts
    iwtsssstvfcgvssevpgwswddgailpfdidk