PDB entry 3sab

View 3sab on RCSB PDB site
Description: Crystal structure of wild-type HIV-1 protease in complex with AF78
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, drug resistance, drug design, protease inhibitors, AIDS, aspartyl protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-06-02, released 2012-06-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.195
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: Gag-Pol, pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38732 (0-98)
    • engineered mutation (6)
  Domains in SCOPe 2.04: d3saba_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: Gag-Pol, pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38732 (0-98)
    • engineered mutation (6)
  Domains in SCOPe 2.04: d3sabb_
• Heterogens: PO4, F78, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3sabA (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3sabB (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf