PDB entry 3sa9
View 3sa9 on RCSB PDB site
Description: Crystal structure of Wild-type HIV-1 protease in complex With AF68
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, drug resistance, drug design, protease inhibitors, AIDS, aspartyl protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2011-06-02, released
2012-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-11-08, with a file datestamp of
2017-11-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: Gag-Pol, pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3sa9a_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: Gag-Pol, pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3sa9b_ - Heterogens: A68, PO4, ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3sa9A (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3sa9B (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf