PDB entry 3sa3

View 3sa3 on RCSB PDB site
Description: Crystal structure of wild-type HIV-1 protease in complex with AG23
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, drug resistance, drug design, protease inhibitors, AIDS, aspartyl protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-06-02, released 2012-06-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.174
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: Gag-Pol, pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot O38732 (0-98)
      • engineered mutation (6)
    Domains in SCOPe 2.05: d3sa3a_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: Gag-Pol, pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot O38732 (0-98)
      • engineered mutation (6)
    Domains in SCOPe 2.05: d3sa3b_
  • Heterogens: ACT, PO4, 23X, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sa3A (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sa3B (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptpvniigrnlltqigctlnf