PDB entry 3sa2

View 3sa2 on RCSB PDB site
Description: Bacuills anthracis Dihydrofolate Reductase bound propargyl-linked TMP analog, UCP1014
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2011-06-02, released 2012-06-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.235
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS2083, BA_2237, dfrA, GBAA2237, GBAA_2237
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81R22 (3-164)
      • expression tag (0-2)
      • engineered mutation (4)
    Domains in SCOPe 2.05: d3sa2a_
  • Chain 'B':
    Compound: dihydrofolate reductase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS2083, BA_2237, dfrA, GBAA2237, GBAA_2237
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81R22 (3-164)
      • expression tag (0-2)
      • engineered mutation (4)
    Domains in SCOPe 2.05: d3sa2b_
  • Heterogens: NAP, 7DR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sa2A (A:)
    hhhmrvsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpg
    rrniivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitki
    hhafegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sa2B (B:)
    hhhmrvsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpg
    rrniivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitki
    hhafegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq