PDB entry 3sa0

View 3sa0 on RCSB PDB site
Description: Complex of ERK2 with norathyriol
Class: transferase/transferase inhibitor
Keywords: norathyriol complex, signal-regulated kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-06-02, released 2011-12-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.166
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ERK2, MAPK1, PRKM1, PRKM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3sa0a_
  • Heterogens: NRA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sa0A (A:)
    maaaaaagagpemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfe
    hqtycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqh
    lsndhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdh
    tgflteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhi
    lgilgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphk
    rieveqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sa0A (A:)
    aaaagagpemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqt
    ycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsn
    dhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgf
    lteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgi
    lgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrie
    veqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyrs