PDB entry 3s9y

View 3s9y on RCSB PDB site
Description: Crystal Structure of P. falciparum orotidine 5'-monophosphate decarboxylase complexed with 5-fluoro-6-amino-UMP in space group P21, produced from 5-fluoro-6-azido-UMP
Class: lyase
Keywords: P. falciparum, orotidine 5'-monophosphate decarboxylase, 5-fluoro-6-amino-UMP, 5-fluoro-6-azido-UMP, decarboxylase, LYASE
Deposited on 2011-06-02, released 2012-04-18
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.165
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: gi|9310996, PF10_0225
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IJH3 (19-341)
      • expression tag (11-18)
    Domains in SCOPe 2.02: d3s9ya_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: gi|9310996, PF10_0225
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IJH3 (19-End)
      • expression tag (18)
    Domains in SCOPe 2.02: d3s9yb_
  • Chain 'C':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: gi|9310996, PF10_0225
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3s9yc_
  • Chain 'D':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: gi|9310996, PF10_0225
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3s9yd_
  • Heterogens: FNU, SO4, PGE, PEG, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s9yA (A:)
    mgsshhhhhhssglvprgsmgfkvklekrrnaintclcigldpdekdienfmknekenny
    nnikknlkekyinnvsikkdillkapdniireekseeffyffnhfcfyiinetnkyaltf
    kmnfafyipygsvgidvlknvfdylyelniptildmkindigntvknyrkfifeylksds
    ctvniymgtnmlkdicydeeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqea
    lnmssylnleqnnefigfvvgansydemnyirtyfpncyilspgigaqngdlhktltngy
    hksyekilinigraitknpypqkaaqmyydqinailkqnmes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s9yA (A:)
    sglvprgsmgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkeky
    innvsikkdillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipyg
    svgidvlknvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnm
    lkdicydeeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleq
    nnefigfvvgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilini
    graitknpypqkaaqmyydqinailkqnmes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3s9yB (B:)
    mgsshhhhhhssglvprgsmgfkvklekrrnaintclcigldpdekdienfmknekenny
    nnikknlkekyinnvsikkdillkapdniireekseeffyffnhfcfyiinetnkyaltf
    kmnfafyipygsvgidvlknvfdylyelniptildmkindigntvknyrkfifeylksds
    ctvniymgtnmlkdicydeeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqea
    lnmssylnleqnnefigfvvgansydemnyirtyfpncyilspgigaqngdlhktltngy
    hksyekilinigraitknpypqkaaqmyydqinailkqnmes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s9yB (B:)
    smgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsik
    kdillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvl
    knvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyd
    eeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigf
    vvgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitkn
    pypqkaaqmyydqinailkqnme
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3s9yC (C:)
    mgsshhhhhhssglvprgsmgfkvklekrrnaintclcigldpdekdienfmknekenny
    nnikknlkekyinnvsikkdillkapdniireekseeffyffnhfcfyiinetnkyaltf
    kmnfafyipygsvgidvlknvfdylyelniptildmkindigntvknyrkfifeylksds
    ctvniymgtnmlkdicydeeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqea
    lnmssylnleqnnefigfvvgansydemnyirtyfpncyilspgigaqngdlhktltngy
    hksyekilinigraitknpypqkaaqmyydqinailkqnmes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s9yC (C:)
    mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
    dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
    nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
    eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
    vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
    ypqkaaqmyydqinailkqnm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3s9yD (D:)
    mgsshhhhhhssglvprgsmgfkvklekrrnaintclcigldpdekdienfmknekenny
    nnikknlkekyinnvsikkdillkapdniireekseeffyffnhfcfyiinetnkyaltf
    kmnfafyipygsvgidvlknvfdylyelniptildmkindigntvknyrkfifeylksds
    ctvniymgtnmlkdicydeeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqea
    lnmssylnleqnnefigfvvgansydemnyirtyfpncyilspgigaqngdlhktltngy
    hksyekilinigraitknpypqkaaqmyydqinailkqnmes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s9yD (D:)
    gfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikkd
    illkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlkn
    vfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicydee
    knkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfvv
    gansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknpy
    pqkaaqmyydqinailkqnm