PDB entry 3s9b

View 3s9b on RCSB PDB site
Description: Russell's viper venom serine proteinase, RVV-V (open-form)
Class: hydrolase
Keywords: serine proteinase, double six-stranded beta-barrels, Hydrolase, glycosylation
Deposited on 2011-06-01, released 2011-09-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vipera russelli proteinase RVV-V gamma
    Species: Daboia russellii siamensis [TaxId:343250]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3s9ba_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3s9bA (A:)
vvggdecninehpflvalytsasstihcagalinrewvltaahcdrrniriklgmhskni
rnedeqirvprgkyfclntkfpngldkdimlirlrrpvtysthiapvslpsrsrgvgsrc
rimgwgkistttypdvphctnifivkhkwceplypwvpadsrtlcagilkggrdtchgds
ggplicngemhgivaggsepcgqhlkpavytkvfdynnwiqsiiagnrtvtcpp