PDB entry 3s9a

View 3s9a on RCSB PDB site
Description: Russell's viper venom serine proteinase, RVV-V (closed-form)
Class: hydrolase
Keywords: serine proteinase, double six-stranded beta-barrels, Hydrolase, glycosylation
Deposited on 2011-06-01, released 2011-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vipera russelli proteinase RVV-V gamma
    Species: Daboia russellii siamensis [TaxId:343250]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3s9aa_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3s9aA (A:)
vvggdecninehpflvalytsasstihcagalinrewvltaahcdrrniriklgmhskni
rnedeqirvprgkyfclntkfpngldkdimlirlrrpvtysthiapvslpsrsrgvgsrc
rimgwgkistttypdvphctnifivkhkwceplypwvpadsrtlcagilkggrdtchgds
ggplicngemhgivaggsepcgqhlkpavytkvfdynnwiqsiiagnrtvtcpp