PDB entry 3s97

View 3s97 on RCSB PDB site
Description: PTPRZ CNTN1 complex
Class: cell adhesion
Keywords: Carbonic anhdyrase like Immunoglobulin, CELL ADHESION complex, CELL ADHESION
Deposited on 2011-05-31, released 2011-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-type tyrosine-protein phosphatase zeta
    Species: Homo sapiens [TaxId:9606]
    Gene: HTPZP2, PTPRZ, PTPRZ1, PTPRZ2, PTPZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3s97a_
  • Chain 'B':
    Compound: Receptor-type tyrosine-protein phosphatase zeta
    Species: Homo sapiens [TaxId:9606]
    Gene: HTPZP2, PTPRZ, PTPRZ1, PTPRZ2, PTPZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3s97b_
  • Chain 'C':
    Compound: Contactin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CNTN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3s97c1
  • Chain 'D':
    Compound: Contactin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CNTN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3s97d1, d3s97d2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s97A (A:)
    gpgseeigwsytgalnqknwgkkyptcnspkqspinidedltqvnvnlkklkfqgwdkts
    lentfihntgktveinltndyrvsggvsemvfkaskitfhwgkcnmssdgsehslegqkf
    plemqiycfdadrfssfeeavkgkgklralsilfevgteenldfkaiidgvesvsrfgkq
    aaldpfillnllpnstdkyyiyngsltsppctdtvdwivfkdtvsisesqlavfcevltm
    qqsgyvmlmdylqnnfreqqykfsrqvfssytg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s97A (A:)
    igwsytgalnqknwgkkyptcnspkqspinidedltqvnvnlkklkfqgwdktslentfi
    hntgktveinltndyrvsggvsemvfkaskitfhwgkcnmssdgsehslegqkfplemqi
    ycfdadrfssfeeavkgkgklralsilfevgteenldfkaiidgvesvsrfgkqaaldpf
    illnllpnstdkyyiyngsltsppctdtvdwivfkdtvsisesqlavfcevltmqqsgyv
    mlmdylqnnfreqqykfsrqvfssyt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3s97B (B:)
    gpgseeigwsytgalnqknwgkkyptcnspkqspinidedltqvnvnlkklkfqgwdkts
    lentfihntgktveinltndyrvsggvsemvfkaskitfhwgkcnmssdgsehslegqkf
    plemqiycfdadrfssfeeavkgkgklralsilfevgteenldfkaiidgvesvsrfgkq
    aaldpfillnllpnstdkyyiyngsltsppctdtvdwivfkdtvsisesqlavfcevltm
    qqsgyvmlmdylqnnfreqqykfsrqvfssytg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s97B (B:)
    gwsytgalnqknwgkkyptcnspkqspinidedltqvnvnlkklkfqgwdktslentfih
    ntgktveinltndyrvsggvsemvfkaskitfhwgkcnmssdgsehslegqkfplemqiy
    cfdadrfssfeeavkgkgklralsilfevgteenldfkaiidgvesvsrfgkqaaldpfi
    llnllpnstdkyyiyngsltsppctdtvdwivfkdtvsisesqlavfcevltmqqsgyvm
    lmdylqnnfreqqykfsrqvfssyt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3s97C (C:)
    gpgsgyldpfppeerpevrvkegkgmvllcdppyhfpddlsyrwllnefpvfitmdkrrf
    vsqtngnlyianveasdkgnyscfvsspsitksvfskfiplipiperttkpypadivvqf
    kdvyalmgqnvtlecfalgnpvpdirwrkvlepmpstaeistsgavlkifniqledegiy
    eceaenirgkdkhqariyvqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s97C (C:)
    gyldpfppeerpevrvkegkgmvllcdppyhfpddlsyrwllnefpvfitmdkrrfvsqt
    ngnlyianveasdkgnyscfvsspsitksvfskfiplipiperttkpypadivvqfkdvy
    almgqnvtlecfalgnpvpdirwrkvlepmpstaeistsgavlkifniqledegiyecea
    enirgkdkhqariyvqa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3s97D (D:)
    gpgsgyldpfppeerpevrvkegkgmvllcdppyhfpddlsyrwllnefpvfitmdkrrf
    vsqtngnlyianveasdkgnyscfvsspsitksvfskfiplipiperttkpypadivvqf
    kdvyalmgqnvtlecfalgnpvpdirwrkvlepmpstaeistsgavlkifniqledegiy
    eceaenirgkdkhqariyvqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s97D (D:)
    gyldpfppeerpevrvkegkgmvllcdppyhfpddlsyrwllnefpvfitmdkrrfvsqt
    ngnlyianveasdkgnyscfvsspsitksvfskfiplipiperttkpypadivvqfkdvy
    almgqnvtlecfalgnpvpdirwrkvlepmpstaeistsgavlkifniqledegiyecea
    enirgkdkhqariyvqa