PDB entry 3s91

View 3s91 on RCSB PDB site
Description: Crystal Structure of the first bromodomain of human BRD3 in complex with the inhibitor JQ1
Class: unknown function
Keywords: BRD3, Bromodomain containing protein 3, ORFX, RING3 like gene, RING3L, JQ1, Structural Genomics, Structural Genomics Consortium, SGC, UNKNOWN FUNCTION
Deposited on 2011-05-31, released 2011-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.197
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bromodomain-containing protein 3
  Species: Homo sapiens [TaxId:9606]
  Gene: BRD3, KIAA0043, RING3L
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15059
  Domains in SCOPe 2.08: d3s91a_
• Heterogens: JQ1, IPA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3s91A (A:)
  smpevsnpskpgrktnqlqymqnvvvktlwkhqfawpfyqpvdaiklnlpdyhkiiknpm
  dmgtikkrlennyywsasecmqdfntmftncyiynkptddivlmaqalekiflqkvaqmp
  qee
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3s91A (A:)
  tnqlqymqnvvvktlwkhqfawpfyqpvdaiklnlpdyhkiiknpmdmgtikkrlennyy
  wsasecmqdfntmftncyiynkptddivlmaqalekiflqkvaqmpq