PDB entry 3s6j

View 3s6j on RCSB PDB site
Description: The crystal structure of a hydrolase from Pseudomonas syringae
Class: hydrolase
Keywords: Structural Genomics, PSI-2, hydrolase, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2011-05-25, released 2011-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrolase, haloacid dehalogenase-like family
    Species: Pseudomonas syringae pv. tomato [TaxId:323]
    Gene: PSPTO0276, PSPTO_0276
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3s6ja_
  • Chain 'B':
    Compound: Hydrolase, haloacid dehalogenase-like family
    Species: Pseudomonas syringae pv. tomato [TaxId:323]
    Gene: PSPTO0276, PSPTO_0276
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3s6jb_
  • Chain 'C':
    Compound: Hydrolase, haloacid dehalogenase-like family
    Species: Pseudomonas syringae pv. tomato [TaxId:323]
    Gene: PSPTO0276, PSPTO_0276
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3s6jc_
  • Chain 'D':
    Compound: Hydrolase, haloacid dehalogenase-like family
    Species: Pseudomonas syringae pv. tomato [TaxId:323]
    Gene: PSPTO0276, PSPTO_0276
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3s6jd_
  • Chain 'E':
    Compound: Hydrolase, haloacid dehalogenase-like family
    Species: Pseudomonas syringae pv. tomato [TaxId:323]
    Gene: PSPTO0276, PSPTO_0276
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3s6je_
  • Chain 'F':
    Compound: Hydrolase, haloacid dehalogenase-like family
    Species: Pseudomonas syringae pv. tomato [TaxId:323]
    Gene: PSPTO0276, PSPTO_0276
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3s6jf_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s6jA (A:)
    mslrpqtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmlksls
    retgmsitdeqaerlsekhaqayerlqhqiialpgavelletldkenlkwciatsggidt
    atinlkalkldinkinivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaa
    rrckatgvgllsggydigeleragalrvyedpldllnhldeiasreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s6jA (A:)
    pqtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmlkslsreit
    deqaerlsekhaqayerlqhqiialpgavelletldkenlkwciatsggidtatinlkal
    kldinkinivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaarrckatgv
    gllsggydigeleragalrvyedpldllnhldeias
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3s6jB (B:)
    mslrpqtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmlksls
    retgmsitdeqaerlsekhaqayerlqhqiialpgavelletldkenlkwciatsggidt
    atinlkalkldinkinivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaa
    rrckatgvgllsggydigeleragalrvyedpldllnhldeiasreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s6jB (B:)
    qtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmlitdeqaerl
    sekhaqayerlqhqiialpgavelletldkenlkwciatsggidtatinlkalkldinki
    nivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaarrckatgvgllsggy
    digeleragalrvyedpldllnhldeias
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3s6jC (C:)
    mslrpqtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmlksls
    retgmsitdeqaerlsekhaqayerlqhqiialpgavelletldkenlkwciatsggidt
    atinlkalkldinkinivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaa
    rrckatgvgllsggydigeleragalrvyedpldllnhldeiasreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s6jC (C:)
    qtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmtgmsitdeqa
    erlsekhaqayerlqhqiialpgavelletldkenlkwciatsggidtatinlkalkldi
    nkinivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaarrckatgvglls
    ggydigeleragalrvyedpldllnhldeias
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3s6jD (D:)
    mslrpqtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmlksls
    retgmsitdeqaerlsekhaqayerlqhqiialpgavelletldkenlkwciatsggidt
    atinlkalkldinkinivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaa
    rrckatgvgllsggydigeleragalrvyedpldllnhldeiasreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s6jD (D:)
    qtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmlkslsretit
    deqaerlsekhaqayerlqhqiialpgavelletldkenlkwciatsggidtatinlkal
    kldinkinivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaarrckatgv
    gllsggydigeleragalrvyedpldllnhldeias
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3s6jE (E:)
    mslrpqtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmlksls
    retgmsitdeqaerlsekhaqayerlqhqiialpgavelletldkenlkwciatsggidt
    atinlkalkldinkinivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaa
    rrckatgvgllsggydigeleragalrvyedpldllnhldeiasreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s6jE (E:)
    pqtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmlkslsretg
    msitdeqaerlsekhaqayerlqhqiialpgavelletldkenlkwciatsggidtatin
    lkalkldinkinivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaarrck
    atgvgllsggydigeleragalrvyedpldllnhldeias
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3s6jF (F:)
    mslrpqtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmlksls
    retgmsitdeqaerlsekhaqayerlqhqiialpgavelletldkenlkwciatsggidt
    atinlkalkldinkinivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaa
    rrckatgvgllsggydigeleragalrvyedpldllnhldeiasreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s6jF (F:)
    qtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmlkslsretgm
    sitdeqaerlsekhaqayerlqhqiialpgavelletldkenlkwciatsggidtatinl
    kalkldinkinivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaarrcka
    tgvgllsggydigeleragalrvyedpldllnhldeias