PDB entry 3s4y

View 3s4y on RCSB PDB site
Description: Crystal structure of human thiamin pyrophosphokinase 1
Class: transferase
Keywords: kinase, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2011-05-20, released 2011-06-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-06-08, with a file datestamp of 2011-06-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiamin pyrophosphokinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Tpk1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3s4ya1, d3s4ya2
  • Chain 'B':
    Compound: Thiamin pyrophosphokinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Tpk1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3s4yb1, d3s4yb2
  • Heterogens: TPP, SO4, CA, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s4yA (A:)
    mhhhhhhssgrenlyfqggnlkyclvilnqpldnyfrhlwnkallracadgganrlydit
    egeresflpefingdfdsirpevreyyatkgcelistpdqdhtdftkclkmlqkkieekd
    lkvdvivtlgglagrfdqimasvntlfqathitpfpiiiiqeesliyllqpgkhrlhvdt
    gmegdwcglipvgqpcmqvtttglkwnltndvlafgtlvstsntydgsgvvtvetdhpll
    wtmaiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s4yA (A:)
    nlkyclvilnqpldnyfrhlwnkallracadgganrlyditegeresflpefingdfdsi
    rpevreyyatkgcelistpdqdhtdftkclkmlqkkieekdlkvdvivtlgglagrfdqi
    masvntlfqathitpfpiiiiqeesliyllqpgkhrlhvmegdwcglipvgqpcmqvttt
    glkwnltndvlafgtlvstsntydgsgvvtvetdhpllwtmaik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3s4yB (B:)
    mhhhhhhssgrenlyfqggnlkyclvilnqpldnyfrhlwnkallracadgganrlydit
    egeresflpefingdfdsirpevreyyatkgcelistpdqdhtdftkclkmlqkkieekd
    lkvdvivtlgglagrfdqimasvntlfqathitpfpiiiiqeesliyllqpgkhrlhvdt
    gmegdwcglipvgqpcmqvtttglkwnltndvlafgtlvstsntydgsgvvtvetdhpll
    wtmaiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s4yB (B:)
    nlkyclvilnqpldnyfrhlwnkallracadgganrlyditegeresflpefingdfdsi
    rpevreyyatkgcelistpdqdhtdftkclkmlqkkieekdlkvdvivtlgglagrfdqi
    masvntlfqathitpfpiiiiqeesliyllqpgkhrlhvmegdwcglipvgqpcmqvttt
    glkwnltndvlafgtlvstsntydgsgvvtvetdhpllwtmaik