PDB entry 3s4q

View 3s4q on RCSB PDB site
Description: P38 alpha kinase complexed with a pyrazolo-triazine based inhibitor
Class: transferase/transferase inhibitor
Keywords: P38 MAP KINASE, SERINE/THREONINE-PROTEIN KINASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-05-20, released 2012-02-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.26
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: CSBP, CSBP1, CSBP2, CSPB1, MAPK14, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3s4qa_
  • Heterogens: NK0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s4qA (A:)
    mahhhhhsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkk
    lsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadln
    nivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarh
    tddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkl
    ilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsd
    kritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
    qeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s4qA (A:)
    erptfyrqelnktiwevperyqnlspvgsvcaafdtktglrvavkklsrpfqsiihakrt
    yrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivqkltddhvqfl
    iyqilrglkyihsadiihrdlkpsnlavnedcelkildfglaatrwyrapeimynqtvdi
    wsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltqmp
    kmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqs
    fesrdllidewksltydevisfvppp