PDB entry 3s4j

View 3s4j on RCSB PDB site
Description: Human FDPS Synthase in Complex with a Rigid Analog of Risedronate
Class: transferase
Keywords: Mainly Alpha Helix, Isoprene, Lipid, Steroid Biosynthesis, Magnesium Binding, TRANSFERASE
Deposited on 2011-05-19, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.188
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl pyrophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: FDPS, FPS, KIAA1293
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3s4ja_
  • Heterogens: UNV, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s4jA (A:)
    snsdvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltv
    vvafrelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgv
    gldaindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvd
    lvrftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqdd
    yldlfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkal
    yeeldlpavflqyeedsyshimalieqyaaplppavflglarkiykrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s4jA (A:)
    dvyaqekqdfvqhfsqivrvltedehpeigdaiarlkevleynaiggkynrgltvvvafr
    elveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgldai
    ndanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvrft
    ekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyldlf
    gdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyeeld
    lpavflqyeedsyshimalieqyaaplppavflglarkiy