PDB entry 3s3v

View 3s3v on RCSB PDB site
Description: human dihydrofolate reductase Q35K/N64F double mutant binary complex with trimethoprim
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: novel second binding site, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2011-05-18, released 2011-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.192
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: DHFR, pds5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00374 (0-185)
      • engineered mutation (34)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d3s3va_
  • Heterogens: TOP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3s3vA (A:)
    vgslncivavsqnmgigkngdlpwpplrnefryfkrmtttssvegkqnlvimgkktwfsi
    pekfrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
    ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
    vyeknd