SCOPe 2.08: Structural Classification of Proteins

PDB entry 3s3t

View 3s3t on RCSB PDB site
Description: Universal stress protein UspA from Lactobacillus plantarum
Class: chaperone
Keywords: structural genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, nucleotide-binding protein, Unknown function, CHAPERONE
Deposited on 2011-05-18, released 2011-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Nucleotide-binding protein, universal stress protein UspA family
Species: Lactobacillus plantarum [TaxId:1590]
Gene: lp_1163
Database cross-references and differences (RAF-indexed):
- Uniprot Q88XN4 (3-145)
  - expression tag (1-2)
Domains in SCOPe 2.08: d3s3ta1, d3s3ta2
Chain 'B':
Compound: Nucleotide-binding protein, universal stress protein UspA family
Species: Lactobacillus plantarum [TaxId:1590]
Gene: lp_1163
Database cross-references and differences (RAF-indexed):
- Uniprot Q88XN4 (3-145)
  - expression tag (2)
Domains in SCOPe 2.08: d3s3tb1, d3s3tb2
Chain 'C':
Compound: Nucleotide-binding protein, universal stress protein UspA family
Species: Lactobacillus plantarum [TaxId:1590]
Gene: lp_1163
Database cross-references and differences (RAF-indexed):
- Uniprot Q88XN4 (3-145)
  - expression tag (1-2)
Domains in SCOPe 2.08: d3s3tc1, d3s3tc2
Chain 'D':
Compound: Nucleotide-binding protein, universal stress protein UspA family
Species: Lactobacillus plantarum [TaxId:1590]
Gene: lp_1163
Database cross-references and differences (RAF-indexed):
- Uniprot Q88XN4 (3-145)
  - expression tag (1-2)
Domains in SCOPe 2.08: d3s3td1, d3s3td2
Chain 'E':
Compound: Nucleotide-binding protein, universal stress protein UspA family
Species: Lactobacillus plantarum [TaxId:1590]
Gene: lp_1163
Database cross-references and differences (RAF-indexed):
- Uniprot Q88XN4 (3-145)
  - expression tag (1-2)
Domains in SCOPe 2.08: d3s3te1, d3s3te2
Chain 'F':
Compound: Nucleotide-binding protein, universal stress protein UspA family
Species: Lactobacillus plantarum [TaxId:1590]
Gene: lp_1163
Database cross-references and differences (RAF-indexed):
- Uniprot Q88XN4 (3-145)
  - expression tag (2)
Domains in SCOPe 2.08: d3s3tf1, d3s3tf2
Chain 'G':
Compound: Nucleotide-binding protein, universal stress protein UspA family
Species: Lactobacillus plantarum [TaxId:1590]
Gene: lp_1163
Database cross-references and differences (RAF-indexed):
- Uniprot Q88XN4 (3-145)
  - expression tag (2)
Domains in SCOPe 2.08: d3s3tg1, d3s3tg2
Chain 'H':
Compound: Nucleotide-binding protein, universal stress protein UspA family
Species: Lactobacillus plantarum [TaxId:1590]
Gene: lp_1163
Database cross-references and differences (RAF-indexed):
- Uniprot Q88XN4 (3-145)
  - expression tag (2)
Domains in SCOPe 2.08: d3s3th1, d3s3th2
Heterogens: ATP, CA, GOL, ACT, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3s3tA (A:)
snarytnilvpvdssdaaqaafteavniaqrhqanltalyvvddsayhtpaldpvlsell
daeaahakdamrqrqqfvattsapnlkteisygipkhtiedyakqhpeidlivlgatgtn
sphrvavgsttsyvvdhapcnvivir