PDB entry 3s34

View 3s34 on RCSB PDB site
Description: Structure of the 1121B Fab fragment
Class: immune system
Keywords: VEGF receptor domain 3, IMMUNE SYSTEM
Deposited on 2011-05-17, released 2011-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 1121B Fab heavy chain
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3S34 (0-End)
  • Chain 'L':
    Compound: 1121B Fab light chain
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3S34 (0-213)
    Domains in SCOPe 2.07: d3s34l1, d3s34l2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3s34L (L:)
    diqmtqspssvsasigdrvtitcrasqgidnwlgwyqqkpgkapklliydasnldtgvps
    rfsgsgsgtyftltisslqaedfavyfcqqakafpptfgggtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec