PDB entry 3s13

View 3s13 on RCSB PDB site
Description: Crystal structure of H5N1 influenza virus hemagglutinin, strain YU562 crystal form 2
Class: viral protein
Keywords: hemagglutinin, viral protein, viral envelope protein, viral fusion protein
Deposited on 2011-05-14, released 2011-12-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: 0.239
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:196426]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3s13a_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:196426]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s13A (A:)
    dlgsmadpgylledqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgv
    kplilrdcsvagwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsr
    inhfekiqiipksswsnheassgvssacpylgkssffrnvvwlikknsayptikrsynnt
    nqedllvlwgihhpndaaeqtklyqnpttyisvgtstlnqrlvpkiatrskvngqsgrme
    ffwtilkpndainfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgains
    smpfhnihpltigecpkyvksnrlvlatglrntpqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s13A (A:)
    lekthngklcdldgvkplilrdcsvagwllgnpmcdefinvpewsyivekaspandlcyp
    gdfndyeelkhllsrinhfekiqiipksswsnheassgvssacpylgkssffrnvvwlik
    knsayptikrsynntnqedllvlwgihhpndaaeqtklyqnpttyisvgtstlnqrlvpk
    iatrskvngqsgrmeffwtilkpndainfesngnfiapeyaykivkkgdsaimkseleyg
    ncntkcqtpmgainssmpfhnihpltigecpkyvksn
    

  • Chain 'B':
    No sequence available.