PDB entry 3s12

View 3s12 on RCSB PDB site
Description: Crystal structure of H5N1 influenza virus hemagglutinin, strain YU562 crystal form 1
Class: viral protein
Keywords: hemagglutinin, viral protein, viral envelope protein, viral fusion protein
Deposited on 2011-05-14, released 2011-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.219
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:196426]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q80A30 (13-End)
      • expression tag (12)
    Domains in SCOPe 2.06: d3s12a1, d3s12a2
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:196426]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3s12b_
  • Heterogens: SO4, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s12A (A:)
    dlgsmadpgylledqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgv
    kplilrdcsvagwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsr
    inhfekiqiipksswsnheassgvssacpylgkssffrnvvwlikknsayptikrsynnt
    nqedllvlwgihhpndaaeqtklyqnpttyisvgtstlnqrlvpkiatrskvngqsgrme
    ffwtilkpndainfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgains
    smpfhnihpltigecpkyvksnrlvlatglrntpqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s12A (A:)
    edqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvag
    wllgnpmcdnvpewsyivekaspandlcypgdfndyeelkhllsrinhfekiqiipkssw
    snheassgvssacpylgkssffrnvvwlikknsayptikrsynntnqedllvlwgihhpn
    daaeqtklyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndainfe
    sngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihpltigec
    pkyvksnrlvlatglrnt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3s12B (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreeisgvrslv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s12B (B:)
    ieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgre
    fnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdn
    akelgngcfefyhkcdnecmesvkngtydypqyseear