PDB entry 3s0k

View 3s0k on RCSB PDB site
Description: Crystal Structure of Human Glycolipid Transfer Protein complexed with glucosylceramide containing oleoyl acyl chain (18:1)
Class: lipid transport
Keywords: GLTP-fold, LIPID TRANSPORT
Deposited on 2011-05-13, released 2012-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.152
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycolipid transfer protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GLTP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3s0ka_
  • Heterogens: 03F, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s0kA (A:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s0kA (A:)
    hllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnpak
    frtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirv
    natkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlflvn
    ytatidviyemytqmnaelnykv