PDB entry 3s05

View 3s05 on RCSB PDB site
Description: mEos2 Fluorescent Protein-Green Form
Class: fluorescent protein
Keywords: Fluorescent Protein
Deposited on 2011-05-13, released 2011-11-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.155
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (0-End)
      • engineered mutation (10)
      • chromophore (63)
      • engineered mutation (69)
      • engineered mutation (73)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (157)
    Domains in SCOPe 2.03: d3s05a_
  • Chain 'B':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (0-End)
      • engineered mutation (10)
      • chromophore (63)
      • engineered mutation (69)
      • engineered mutation (73)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (157)
    Domains in SCOPe 2.03: d3s05b_
  • Chain 'C':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9
      • engineered mutation (10)
      • chromophore (63)
      • engineered mutation (69)
      • engineered mutation (73)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (157)
    Domains in SCOPe 2.03: d3s05c_
  • Chain 'D':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9
      • engineered mutation (10)
      • chromophore (63)
      • engineered mutation (69)
      • engineered mutation (73)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (157)
    Domains in SCOPe 2.03: d3s05d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s05A (A:)
    msaikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfakypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    ygtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s05A (A:)
    msaikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfakypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    ygtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3s05B (B:)
    msaikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfakypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    ygtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s05B (B:)
    msaikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfakypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    ygtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdna
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3s05C (C:)
    msaikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfakypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    ygtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s05C (C:)
    aikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttafh
    ygnrvfakypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfyg
    tnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykakek
    gvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3s05D (D:)
    msaikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfakypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    ygtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s05D (D:)
    aikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttafh
    ygnrvfakypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfyg
    tnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykakek
    gvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn