PDB entry 3rz3

View 3rz3 on RCSB PDB site
Description: Human Cdc34 E2 in complex with CC0651 inhibitor
Class: ligase/ligase inhibitor
Keywords: ubiquitin conjugating enzyme domain, E2 domain, LIGASE-LIGASE INHIBITOR complex
Deposited on 2011-05-11, released 2011-07-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.223
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 R1
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC34, UBCH3, UBE2R1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49427 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.05: d3rz3a_
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2 R1
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC34, UBCH3, UBE2R1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49427 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.05: d3rz3b_
  • Chain 'C':
    Compound: Ubiquitin-conjugating enzyme E2 R1
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC34, UBCH3, UBE2R1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3rz3c_
  • Chain 'D':
    Compound: Ubiquitin-conjugating enzyme E2 R1
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC34, UBCH3, UBE2R1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3rz3d_
  • Heterogens: U94, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rz3A (A:)
    gamgspssqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkar
    lkfpidypysppafrfltkmwhpniyetgdvcisilhppvddpqsgelpserwnptqnvr
    tillsvisllnepntfspanvdasvmyrkwkeskgkdreytdiirkqvlgtkvdaerdgv
    kvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rz3A (A:)
    spssqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfp
    idypysppafrfltkmwhpniyetgdvcisilerwnptqnvrtillsvisllnepntfsp
    anvdasvmyrkwkeskgkdreytdiirkqvlgtkvdaerdgvkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rz3B (B:)
    gamgspssqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkar
    lkfpidypysppafrfltkmwhpniyetgdvcisilhppvddpqsgelpserwnptqnvr
    tillsvisllnepntfspanvdasvmyrkwkeskgkdreytdiirkqvlgtkvdaerdgv
    kvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rz3B (B:)
    spssqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfp
    idypysppafrfltkmwhpniyetgdvcisilerwnptqnvrtillsvisllnepntfsp
    anvdasvmyrkwkeskgkdreytdiirkqvlgtkvdaerdgvkv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rz3C (C:)
    gamgspssqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkar
    lkfpidypysppafrfltkmwhpniyetgdvcisilhppvddpqsgelpserwnptqnvr
    tillsvisllnepntfspanvdasvmyrkwkeskgkdreytdiirkqvlgtkvdaerdgv
    kvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rz3C (C:)
    sqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpidy
    pysppafrfltkmwhpniyetgdvcirwnptqnvrtillsvisllnepntfspanvdasv
    myrkwkeskgkdreytdiirkqvlgtkvdaerdgvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3rz3D (D:)
    gamgspssqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkar
    lkfpidypysppafrfltkmwhpniyetgdvcisilhppvddpqsgelpserwnptqnvr
    tillsvisllnepntfspanvdasvmyrkwkeskgkdreytdiirkqvlgtkvdaerdgv
    kvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rz3D (D:)
    lllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpidypysp
    pafrfltkmwhpniyetgdvcnvrtillsvisllnepntfspanvdasvmyrkwkeskgk
    dreytdiirkqvlgtkvdaerdgvkv