PDB entry 3rys

View 3rys on RCSB PDB site
Description: The crystal structure of adenine deaminase (AAur1117) from Arthrobacter aurescens
Class: hydrolase
Keywords: sgx, hydrolase
Deposited on 2011-05-11, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.203
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosine deaminase 1
    Species: Arthrobacter aurescens [TaxId:290340]
    Gene: add, add1, AAur_1117
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rysa_
  • Chain 'B':
    Compound: Adenosine deaminase 1
    Species: Arthrobacter aurescens [TaxId:290340]
    Gene: add, add1, AAur_1117
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rysb_
  • Heterogens: ZN, ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rysA (A:)
    metfgekttstappvaelhlhiegtlqpelifalaerngielpyedieelrekyeftdlq
    sfldlyyanmavlqteqdftdmtrayleraaaggvrhaeimmdpqahtsrgvaletcvng
    vanalatseedfgvstlliaaflrdmsedsalevldqllamhapiagigldsaevgnpps
    kferlyqraaeaglrriahageegpasyitealdvlhveridhgircmedtdvvqrlvae
    qvpltvcplsnvrlravdkladhplpemlaiglnvcvnsddpayfggyvddnfeqlvkvl
    efsvpeqatlaansirssfasdarkavlldevtewvkasvtpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rysA (A:)
    ttstappvaelhlhiegtlqpelifalaerngielpyedieelrekyeftdlqsfldlyy
    anmavlqteqdftdmtrayleraaaggvrhaeimmdpqahtsrgvaletcvngvanalat
    seedfgvstlliaaflrdmsedsalevldqllamhapiagigldsaevgnppskferlyq
    raaeaglrriahageegpasyitealdvlhveridhgircmedtdvvqrlvaeqvpltvc
    plsnvrlravdkladhplpemlaiglnvcvnsddpayfggyvddnfeqlvkvlefsvpeq
    atlaansirssfasdarkavlldevtewvkasvtp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rysB (B:)
    metfgekttstappvaelhlhiegtlqpelifalaerngielpyedieelrekyeftdlq
    sfldlyyanmavlqteqdftdmtrayleraaaggvrhaeimmdpqahtsrgvaletcvng
    vanalatseedfgvstlliaaflrdmsedsalevldqllamhapiagigldsaevgnpps
    kferlyqraaeaglrriahageegpasyitealdvlhveridhgircmedtdvvqrlvae
    qvpltvcplsnvrlravdkladhplpemlaiglnvcvnsddpayfggyvddnfeqlvkvl
    efsvpeqatlaansirssfasdarkavlldevtewvkasvtpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rysB (B:)
    appvaelhlhiegtlqpelifalaerngielpyedieelrekyeftdlqsfldlyyanma
    vlqteqdftdmtrayleraaaggvrhaeimmdpqahtsrgvaletcvngvanalatseed
    fgvstlliaaflrdmsedsalevldqllamhapiagigldsaevgnppskferlyqraae
    aglrriahageegpasyitealdvlhveridhgircmedtdvvqrlvaeqvpltvcplsn
    vrlravdkladhplpemlaiglnvcvnsddpayfggyvddnfeqlvkvlefsvpeqatla
    ansirssfasdarkavlldevtewvka