PDB entry 3ryk

View 3ryk on RCSB PDB site
Description: 1.63 Angstrom resolution crystal structure of dTDP-4-dehydrorhamnose 3,5-epimerase (rfbC) from Bacillus anthracis str. Ames with TDP and PPi bound
Class: isomerase
Keywords: dTDP-4-dehydrorhamnose 3, 5-epimerase, rhamnose pathway, structural genomics, infectious diseases, Center for Structural Genomics of Infectious Diseases (CSGID), jelly roll-like topology, The enzyme epimerizes at two carbon centers, the 3 and 5 positions of the sugar ring, ISOMERASE
Deposited on 2011-05-11, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dtdp-4-dehydrorhamnose 3,5-epimerase
    Species: Bacillus anthracis str. Ames [TaxId:198094]
    Gene: BAS1136, BA_1229, GBAA_1229, rfbC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81TP1 (24-End)
      • expression tag (23)
    Domains in SCOPe 2.07: d3ryka1, d3ryka2
  • Chain 'B':
    Compound: dtdp-4-dehydrorhamnose 3,5-epimerase
    Species: Bacillus anthracis str. Ames [TaxId:198094]
    Gene: BAS1136, BA_1229, GBAA_1229, rfbC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81TP1 (24-End)
      • expression tag (23)
    Domains in SCOPe 2.07: d3rykb1, d3rykb2
  • Heterogens: POP, TYD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rykA (A:)
    mhhhhhhssgvdlgtenlyfqsnamkvietnftdaklleprlfgddrgfftesynkkvle
    tlgvthsfvqdnvsysaeagtirglhfqknpkaqtkliqvmqgaiydvivdlrkdsptfk
    qwrgyilsadnhrqllvpkgfahgfctlvphtivmykvdeyysadhdsgvlwndkelaip
    wpvtspilsdkdrilpllqecedsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rykA (A:)
    amkvietnftdaklleprlfgddrgfftesynkkvletlgvthsfvqdnvsysaeagtir
    glhfqknpkaqtkliqvmqgaiydvivdlrkdsptfkqwrgyilsadnhrqllvpkgfah
    gfctlvphtivmykvdeyysadhdsgvlwndkelaipwpvtspilsdkdrilpll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rykB (B:)
    mhhhhhhssgvdlgtenlyfqsnamkvietnftdaklleprlfgddrgfftesynkkvle
    tlgvthsfvqdnvsysaeagtirglhfqknpkaqtkliqvmqgaiydvivdlrkdsptfk
    qwrgyilsadnhrqllvpkgfahgfctlvphtivmykvdeyysadhdsgvlwndkelaip
    wpvtspilsdkdrilpllqecedsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rykB (B:)
    amkvietnftdaklleprlfgddrgfftesynkkvletlgvthsfvqdnvsysaeagtir
    glhfqknpkaqtkliqvmqgaiydvivdlrkdsptfkqwrgyilsadnhrqllvpkgfah
    gfctlvphtivmykvdeyysadhdsgvlwndkelaipwpvtspilsdkdrilpll