PDB entry 3ryg

View 3ryg on RCSB PDB site
Description: 128 hours neutron structure of perdeuterated rubredoxin
Class: electron transport
Keywords: Iron, metal-binding, transport, electron transport
Deposited on 2011-05-11, released 2011-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: NEUT
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: PF1282, rub
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ryga_
  • Heterogens: FE, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rygA (A:)
    makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rygA (A:)
    akwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekl