PDB entry 3ryc

View 3ryc on RCSB PDB site
Description: Tubulin: RB3 stathmin-like domain complex
Class: cell cycle
Keywords: alpha-tubulin, beta-tubulin, gtpase, microtubule, stathmin s-tubulin, subtilisin, tubulin, cell cycle
Deposited on 2011-05-11, released 2011-10-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.172
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tubulin alpha chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0VWZ0 (0-End)
      • see remark 999 (231)
      • see remark 999 (339)
  • Chain 'B':
    Compound: Tubulin beta chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0VWY9 (0-End)
      • see remark 999 (314-315)
      • see remark 999 (332)
      • see remark 999 (364)
  • Chain 'C':
    Compound: Tubulin alpha chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0VWZ0 (0-End)
      • see remark 999 (231)
      • see remark 999 (339)
  • Chain 'D':
    Compound: Tubulin beta chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0VWY9 (0-End)
      • see remark 999 (314-315)
      • see remark 999 (332)
      • see remark 999 (364)
  • Chain 'E':
    Compound: Stathmin-4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: STMN4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63043 (1-141)
      • see remark 999 (0)
      • engineered mutation (10)
      • engineered mutation (16)
    Domains in SCOPe 2.01: d3ryce_
  • Heterogens: GTP, MG, SO4, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >3rycE (E:)
admevielnkatsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky
qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl
qekdkhaeevrknkelkeeasr

    Sequence, based on observed residues (ATOM records): (download) 
    >3rycE (E:)
admevielnkatsgqswevilkppsfdgvperrrdpsleeiqkkleaaeerrkyqeaell
khlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkh
aeevrknkelkeeasr