PDB entry 3ry5

View 3ry5 on RCSB PDB site
Description: Three-dimensional structure of glycosylated fcgammariia (high-responder polymorphism)
Class: immune system
Keywords: fc receptor, cd32, immunoglobulin superfamily, high responder polymorphism, cell membrane, igg-binding protein, immunoglobulin domain, membrane, receptor, transmembrane, immune system
Deposited on 2011-05-11, released 2011-08-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.206
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low affinity immunoglobulin gamma Fc region receptor II-a
    Species: Homo sapiens [TaxId:9606]
    Gene: FCGR2A, CD32, FCG2, FCGR2A1, IGFR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12318 (0-169)
      • engineered mutation (130)
    Domains in SCOPe 2.05: d3ry5a1, d3ry5a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ry5A (A:)
    appkavlkleppwinvlqedsvtltcqgarspesdsiqwfhngnlipthtqpsyrfkann
    ndsgeytcqtgqtslsdpvhltvlsewlvlqtphlefqegetimlrchswkdkplvkvtf
    fqngksqkfsrldptfsipqanhshsgdyhctgnigytlfsskpvtitvq