PDB entry 3rxv

View 3rxv on RCSB PDB site
Description: Crystal structure of Trypsin complexed with benzamide (F05 and F03, cocktail experiment)
Class: hydrolase/hydrolase inhibitor
Keywords: Trypsin-like serine proteases, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-05-10, released 2011-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.163
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cationic trypsin
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00760 (0-222)
  Domains in SCOPe 2.07: d3rxva_
• Heterogens: CA, DMS, BEN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3rxvA (A:)
  ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
  neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
  wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
  vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn