PDB entry 3rwv

View 3rwv on RCSB PDB site
Description: Crystal Structure of apo-form of Human Glycolipid Transfer Protein at 1.5 A resolution
Class: lipid transport
Keywords: GLTP-fold, LIPID TRANSPORT
Deposited on 2011-05-09, released 2012-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycolipid transfer protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GLTP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rwva_
  • Chain 'B':
    Compound: glycolipid transfer protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GLTP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rwvb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rwvA (A:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rwvA (A:)
    aehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnp
    akfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnli
    rvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlfl
    vnytatidviyemytqmnaelnykv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rwvB (B:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rwvB (B:)
    allaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavyd
    tnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhp
    nlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekir
    lflvnytatidviyemytqmnaelnykv