PDB entry 3rv5

View 3rv5 on RCSB PDB site
Description: Crystal structure of human cardiac troponin C regulatory domain in complex with cadmium and deoxycholic acid
Class: contractile protein
Keywords: helix-loop-helix EF-hand motif, Metal ion coordination, calcium sensor, CONTRACTILE PROTEIN
Deposited on 2011-05-06, released 2011-08-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.228
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNC, TNNC1, TNNC1 (Amino acids 1-89)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rv5a_
  • Chain 'B':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNC, TNNC1, TNNC1 (Amino acids 1-89)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rv5b_
  • Chain 'C':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNC, TNNC1, TNNC1 (Amino acids 1-89)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rv5c_
  • Chain 'D':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNC, TNNC1, TNNC1 (Amino acids 1-89)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rv5d_
  • Heterogens: CD, DXC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rv5A (A:)
    mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrcmkdds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rv5A (A:)
    diykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqemid
    evdedgsgtvdfdeflvmmvrcm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rv5B (B:)
    mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrcmkdds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rv5B (B:)
    ykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqemidev
    dedgsgtvdfdeflvmmv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rv5C (C:)
    mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrcmkdds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rv5C (C:)
    diykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqemid
    evdedgsgtvdfdeflvmmvrcm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3rv5D (D:)
    mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrcmkdds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rv5D (D:)
    ykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqemidev
    dedgsgtvdfdeflvmmv