PDB entry 3ruu

View 3ruu on RCSB PDB site
Description: FXR with SRC1 and GSK237
Class: transcription regulator
Keywords: nuclear receptor, alpha-helical sandwich, transcription factor, RXR, transcription co-factors, bile acid, farnesoid, TRANSCRIPTION REGULATOR
Deposited on 2011-05-05, released 2011-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bile acid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: BAR, FXR, HRR1, NR1H4, RIP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ruua_
  • Chain 'B':
    Compound: Nuclear receptor coactivator 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, 37G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ruuA (A:)
    eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk
    klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit
    pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
    penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq
    

  • Chain 'B':
    No sequence available.