PDB entry 3run

View 3run on RCSB PDB site
Description: New strategy to analyze structures of glycopeptide antibiotic-target complexes
Class: hydrolase/antibiotic
Keywords: antibiotic, glycopeptide, native protein ligation, fusion, carboxymethylation of cysteine, vancomycin, HYDROLASE-ANTIBIOTIC complex
Deposited on 2011-05-05, released 2012-06-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.149
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • engineered mutation (53)
      • engineered mutation (96)
      • engineered mutation (163)
      • see remark 999 (164-167)
    Domains in SCOPe 2.05: d3runa_
  • Chain 'B':
    Compound: vancomycin
    Species: Streptomyces orientalis [TaxId:31958]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00681 (0-6)
  • Heterogens: MPD, MRD, PO4, TRS, CL, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3runA (A:)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknackaa

  • Chain 'B':
    No sequence available.