PDB entry 3rud

View 3rud on RCSB PDB site
Description: Alternative analogs as viable substrates of UDP-hexose 4-epimerases
Class: isomerase
Keywords: Rossmann fold, UDP-hexose 4-epimerase, ISOMERASE
Deposited on 2011-05-05, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: WbgU
    Species: Plesiomonas shigelloides [TaxId:703]
    Gene: wbgU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ruda_
  • Chain 'B':
    Compound: WbgU
    Species: Plesiomonas shigelloides [TaxId:703]
    Gene: wbgU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rudb_
  • Chain 'C':
    Compound: WbgU
    Species: Plesiomonas shigelloides [TaxId:703]
    Gene: wbgU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rudc_
  • Chain 'D':
    Compound: WbgU
    Species: Plesiomonas shigelloides [TaxId:703]
    Gene: wbgU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rudd_
  • Heterogens: NAD, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rudA (A:)
    hhhhhhmdiymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfst
    ghqynldevktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdp
    ittnatnitgflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtky
    vneiyaqvyartygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdge
    tsrdfcyidnviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhidkl
    sikyrefrsgdvrhsqadvtkaidllkyrpnikireglrlsmpwyvrflkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rudA (A:)
    ymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynldev
    ktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnatnit
    gflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiyaqvy
    artygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfcyid
    nviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhikyrefrsgdvrh
    sqadvtkaidllkyrpnikireglrlsmpwyvrflk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rudB (B:)
    hhhhhhmdiymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfst
    ghqynldevktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdp
    ittnatnitgflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtky
    vneiyaqvyartygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdge
    tsrdfcyidnviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhidkl
    sikyrefrsgdvrhsqadvtkaidllkyrpnikireglrlsmpwyvrflkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rudB (B:)
    ymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynldev
    ktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnatnit
    gflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiyaqvy
    artygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfcyid
    nviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhikyrefrsgdvrh
    sqadvtkaidllkyrpnikireglrlsmpwyvrflk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rudC (C:)
    hhhhhhmdiymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfst
    ghqynldevktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdp
    ittnatnitgflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtky
    vneiyaqvyartygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdge
    tsrdfcyidnviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhidkl
    sikyrefrsgdvrhsqadvtkaidllkyrpnikireglrlsmpwyvrflkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rudC (C:)
    ymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynldev
    ktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnatnit
    gflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiyaqvy
    artygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfcyid
    nviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhikyrefrsgdvrh
    sqadvtkaidllkyrpnikireglrlsmpwyvrflk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3rudD (D:)
    hhhhhhmdiymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfst
    ghqynldevktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdp
    ittnatnitgflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtky
    vneiyaqvyartygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdge
    tsrdfcyidnviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhidkl
    sikyrefrsgdvrhsqadvtkaidllkyrpnikireglrlsmpwyvrflkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rudD (D:)
    ymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynldev
    ktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnatnit
    gflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiyaqvy
    artygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfcyid
    nviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhikyrefrsgdvrh
    sqadvtkaidllkyrpnikireglrlsmpwyvrflk