PDB entry 3ruc

View 3ruc on RCSB PDB site
Description: Specific recognition of N-acetylated substrates and domain flexibility in WbgU: a UDP-GalNAc 4-epimerase
Class: isomerase
Keywords: Rossmann fold, UDP-hexose 4-epimerase, ISOMERASE
Deposited on 2011-05-04, released 2011-05-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: WbgU
    Species: Plesiomonas shigelloides [TaxId:703]
    Gene: wbgU
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7BJX9
      • engineered mutation (313)
    Domains in SCOPe 2.02: d3ruca_
  • Chain 'B':
    Compound: WbgU
    Species: Plesiomonas shigelloides [TaxId:703]
    Gene: wbgU
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7BJX9
      • engineered mutation (313)
    Domains in SCOPe 2.02: d3rucb_
  • Chain 'C':
    Compound: WbgU
    Species: Plesiomonas shigelloides [TaxId:703]
    Gene: wbgU
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7BJX9
      • engineered mutation (313)
    Domains in SCOPe 2.02: d3rucc_
  • Chain 'D':
    Compound: WbgU
    Species: Plesiomonas shigelloides [TaxId:703]
    Gene: wbgU
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7BJX9
      • engineered mutation (313)
    Domains in SCOPe 2.02: d3rucd_
  • Heterogens: NAD, UD2, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rucA (A:)
    hhhhhhmdiymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfst
    ghqynldevktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdp
    ittnatnitgflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtky
    vneiyaqvyartygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdge
    tsrdfcyidnviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhidkl
    sikyrefrsgdvrasqadvtkaidllkyrpnikireglrlsmpwyvrflkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rucA (A:)
    ymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynldev
    ktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnatnit
    gflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiyaqvy
    artygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfcyid
    nviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhikyrefrsgdvra
    sqadvtkaidllkyrpnikireglrlsmpwyvrflk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rucB (B:)
    hhhhhhmdiymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfst
    ghqynldevktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdp
    ittnatnitgflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtky
    vneiyaqvyartygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdge
    tsrdfcyidnviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhidkl
    sikyrefrsgdvrasqadvtkaidllkyrpnikireglrlsmpwyvrflkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rucB (B:)
    ymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynldev
    ktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnatnit
    gflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiyaqvy
    artygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfcyid
    nviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhikyrefrsgdvra
    sqadvtkaidllkyrpnikireglrlsmpwyvrflk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rucC (C:)
    hhhhhhmdiymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfst
    ghqynldevktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdp
    ittnatnitgflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtky
    vneiyaqvyartygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdge
    tsrdfcyidnviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhidkl
    sikyrefrsgdvrasqadvtkaidllkyrpnikireglrlsmpwyvrflkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rucC (C:)
    ymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynldev
    ktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnatnit
    gflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiyaqvy
    artygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfcyid
    nviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhikyrefrsgdvra
    sqadvtkaidllkyrpnikireglrlsmpwyvrflk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3rucD (D:)
    hhhhhhmdiymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfst
    ghqynldevktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdp
    ittnatnitgflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtky
    vneiyaqvyartygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdge
    tsrdfcyidnviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhidkl
    sikyrefrsgdvrasqadvtkaidllkyrpnikireglrlsmpwyvrflkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rucD (D:)
    ymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynldev
    ktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnatnit
    gflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiyaqvy
    artygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfcyid
    nviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhikyrefrsgdvra
    sqadvtkaidllkyrpnikireglrlsmpwyvrflk