PDB entry 3rub

View 3rub on RCSB PDB site
Description: crystal structure of the unactivated form of ribulose-1,5-bisphosphate carboxylase(slash)oxygenase from tobacco refined at 2.0-angstroms resolution
Deposited on 1990-05-25, released 1992-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1994-04-30, with a file datestamp of 1994-05-17.
Experiment type: -
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3rubL (L:)
    ltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdgltsldryk
    grcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrledlrip
    payvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftk
    ddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtceemikravfarelg
    vpivmhdyltggftantslahycrdnglllhihramhavidrqknhgihfrvlakalrms
    ggdhihsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpvasgg
    ihvwhmpalteifgddsvlqfggmtlghpwgnapgavanrvaleacvkarnegrdlaqeg
    neiireackwspelaaacevwkeivf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rubL (L:)
    ltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstvwtdgltsldrykgrcyr
    iervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrledlrippayvk
    tfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenv
    nsqpfmrwrdrflfcaealykaqaetgeikghylnatagtceemikravfarelgvpivm
    hdyltggftantslahycrdnglllhihramhavidrqknhgihfrvlakalrmsggdhi
    hsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpvasggihvwh
    mpalteifgddsvlqfggmtlghpwgnapgavanrvaleacvkarnegrdlaqegneiir
    eackwspelaaacevwkeivf
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rubS (S:)
    mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
    yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp
    egy