PDB entry 3rub

View 3rub on RCSB PDB site
Description: crystal structure of the unactivated form of ribulose-1,5-bisphosphate carboxylase(slash)oxygenase from tobacco refined at 2.0-angstroms resolution
Class: lyase(carbon-carbon)
Keywords: lyase(carbon-carbon)
Deposited on 1990-05-25, released 1992-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: ribulose 1,5-bisphosphate carboxylase/oxygenase, form III
    Species: NICOTIANA TABACUM [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00876
      • conflict (376)
      • conflict (404)
    Domains in SCOPe 2.06: d3rubl1, d3rubl2
  • Chain 'S':
    Compound: ribulose 1,5-bisphosphate carboxylase/oxygenase, form III
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rubs_
  • Heterogens: SO4, ASN, HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3rubL (L:)
    mspqtetkasvgfkagvkeykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhav
    idrqknhgihfrvlakalrmsggdhihsgtvvgklegerditlgfvdllrddfveqdrsr
    giyftqdwvslpgvlpvasggihvwhmpalteifgddsvlqfggmtlghpwgnapgavan
    rvaleacvkarnegrdlaqegneiireackwspelaaacevwkeivfnfaavdvldk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rubL (L:)
    ltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstvwtdgltsldrykgrcyr
    iervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrledlrippayvk
    tfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenv
    nsqpfmrwrdrflfcaealykaqaetgeikghylnatagtceemikravfarelgvpivm
    hdyltggftantslahycrdnglllhihramhavidrqknhgihfrvlakalrmsggdhi
    hsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpvasggihvwh
    mpalteifgddsvlqfggmtlghpwgnapgavanrvaleacvkarnegrdlaqegneiir
    eackwspelaaacevwkeivf
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rubS (S:)
    mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
    yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp
    egy