PDB entry 3ru7

View 3ru7 on RCSB PDB site
Description: Specific recognition of N-acetylated substrates and domain flexibility in WbgU: a UDP-GalNAc 4-epimerase
Class: isomerase
Keywords: epimerase, Rossmann fold, UDP-GalNAc, 4-epimerase, UDP-hexose 4-epimerase, UDP-hexoses, NAD(H), ISOMERASE
Deposited on 2011-05-04, released 2011-05-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: WbgU
    Species: Plesiomonas shigelloides [TaxId:703]
    Gene: wbgU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ru7a1, d3ru7a2
  • Chain 'B':
    Compound: WbgU
    Species: Plesiomonas shigelloides [TaxId:703]
    Gene: wbgU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ru7b1, d3ru7b2
  • Chain 'C':
    Compound: WbgU
    Species: Plesiomonas shigelloides [TaxId:703]
    Gene: wbgU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ru7c1, d3ru7c2
  • Chain 'D':
    Compound: WbgU
    Species: Plesiomonas shigelloides [TaxId:703]
    Gene: wbgU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ru7d1, d3ru7d2
  • Heterogens: NAD, GLY, NA, UNL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ru7A (A:)
    mdiymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynl
    devktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnat
    nitgflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiya
    qvyartygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfc
    yidnviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhidklsikyre
    frsgdvrhsqadvtkaidllkyrpnikireglrlsmpwyvrflkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ru7A (A:)
    ymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynldev
    ktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnatnit
    gflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiyaqvy
    artygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfcyid
    nviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhikyrefrsgdvrh
    sqadvtkaidllkyrpnikireglrlsmpwyvrflk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ru7B (B:)
    mdiymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynl
    devktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnat
    nitgflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiya
    qvyartygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfc
    yidnviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhidklsikyre
    frsgdvrhsqadvtkaidllkyrpnikireglrlsmpwyvrflkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ru7B (B:)
    ymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynldev
    ktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnatnit
    gflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiyaqvy
    artygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfcyid
    nviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhikyrefrsgdvrh
    sqadvtkaidllkyrpnikireglrlsmpwyvrflk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ru7C (C:)
    mdiymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynl
    devktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnat
    nitgflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiya
    qvyartygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfc
    yidnviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhidklsikyre
    frsgdvrhsqadvtkaidllkyrpnikireglrlsmpwyvrflkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ru7C (C:)
    ymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynldev
    ktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnatnit
    gflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiyaqvy
    artygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfcyid
    nviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhikyrefrsgdvrh
    sqadvtkaidllkyrpnikireglrlsmpwyvrflk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ru7D (D:)
    mdiymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynl
    devktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnat
    nitgflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiya
    qvyartygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfc
    yidnviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhidklsikyre
    frsgdvrhsqadvtkaidllkyrpnikireglrlsmpwyvrflkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ru7D (D:)
    ymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynldev
    ktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnatnit
    gflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiyaqvy
    artygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfcyid
    nviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhikyrefrsgdvrh
    sqadvtkaidllkyrpnikireglrlsmpwyvrflk