PDB entry 3rtu

View 3rtu on RCSB PDB site
Description: Human MMP12 catalytic domain in complex with*N*-Hydroxy-2-(2-(4-methoxyphenyl)ethylsulfonamido)acetamide
Class: hydrolase/hydrolase inhibitor
Keywords: MMP-12, Matrix, metalloproteinase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-05-04, released 2012-07-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-09-19, with a file datestamp of 2012-09-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.227
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (0-157)
      • engineered mutation (65)
    Domains in SCOPe 2.06: d3rtua_
  • Heterogens: ZN, CA, KLJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3rtuA (A:)
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg