PDB entry 3rtt

View 3rtt on RCSB PDB site
Description: Human MMP-12 catalytic domain in complex with*(R)-N*-Hydroxy-1-(phenethylsulfonyl)pyrrolidine-2-carboxamide
Class: hydrolase/hydrolase inhibitor
Keywords: MMP-12, Matrix, metalloproteinase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-05-04, released 2012-07-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-07-04, with a file datestamp of 2012-06-29.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.242
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Macrophage metalloelastase
  Species: Homo sapiens [TaxId:9606]
  Gene: MMP12, HME
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39900 (0-157)
    • engineered mutation (65)
  Domains in SCOPe 2.05: d3rtta_
• Heterogens: ZN, CA, KLH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3rttA (A:)
  gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
  gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
  lghssdpkavmfptykyvdintfrlsaddirgiqslyg