PDB entry 3rt3

View 3rt3 on RCSB PDB site
Description: Complex of influenza virus protein with host anti-viral factor
Class: antiviral protein/viral protein
Keywords: ubiquitin-like domain, ISGylation, ANTIVIRAL PROTEIN-VIRAL PROTEIN complex
Deposited on 2011-05-03, released 2011-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Ubiquitin-like protein ISG15
    Species: Homo sapiens [TaxId:9606]
    Gene: ISG15, G1P2, UCRP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05161
      • engineered mutation (77)
    Domains in SCOPe 2.07: d3rt3b1, d3rt3b2
  • Chain 'C':
    Compound: Non-structural protein 1
    Species: Influenza B virus [TaxId:107412]
    Gene: NS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rt3c_
  • Heterogens: SIN, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rt3B (B:)
    mgwdltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvpl
    asqglgpgstvllvvdksdeplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqdd
    lfwltfegkpledqlplgeyglkplstvfmnlrlrgggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rt3B (B:)
    wdltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplas
    qglgpgstvllvvdksdeplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlf
    wltfegkpledqlplgeyglkplstvfmnlrlr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rt3C (C:)
    madnmtttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrik
    thnksepenkrmsleerkaigvkmmkvllfmdpsagiegfepyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rt3C (C:)
    qievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepe
    nkrmsleerkaigvkmmkvllfmdpsagiegfep