PDB entry 3rsp

View 3rsp on RCSB PDB site
Description: structure of the p93g variant of ribonuclease a
Deposited on 1997-10-20, released 1998-04-22
The last revision prior to the SCOP 1.55 freeze date was dated 1999-08-20, with a file datestamp of 1999-08-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d3rsp__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3rsp_ (-)
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskygncaykttqankhiivacegnpyvpvhf
dasv