PDB entry 3rsh

View 3rsh on RCSB PDB site
Description: Structure of 3-ketoacyl-(acyl-carrier-protein)reductase (FabG) from Vibrio cholerae O1 complexed with NADP+ (space group P62)
Class: oxidoreductase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, OXIREDUCTASE, FabG, acyl carrier protein, Cell plasma, OXIDOREDUCTASE
Deposited on 2011-05-02, released 2011-05-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.134
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VCD_002346
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rsha_
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VCD_002346
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3rshb_
  • Heterogens: SO4, NAP, EDO, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rshA (A:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrg
    vtvntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rshA (A:)
    sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
    lnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrl
    skavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtvn
    tvapgfietdmtkdeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhvngg
    mymi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rshB (B:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrg
    vtvntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rshB (B:)
    msqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgm
    alnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifr
    lskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtv
    ntvapgfietdmtklndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhv
    nggmymi