PDB entry 3rs1

View 3rs1 on RCSB PDB site
Description: Mouse C-type lectin-related protein Clrg
Class: immune system
Keywords: C-type lectin-like, ligand of NK receptor, natural killer cell receptors, Surface of activated T lymphocytes, IMMUNE SYSTEM
Deposited on 2011-05-02, released 2012-05-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-12-19, with a file datestamp of 2012-12-14.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.186
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: C-type lectin domain family 2 member I
  Species: MUS MUSCULUS [TaxId:10090]
  Gene: Clec2i, Clrg, Dcl1, Ocilrp2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WVF9 (0-121)
    • engineered mutation (0)
    • engineered mutation (63)
  Domains in SCOPe 2.04: d3rs1a_
• Chain 'B':
  Compound: C-type lectin domain family 2 member I
  Species: MUS MUSCULUS [TaxId:10090]
  Gene: Clec2i, Clrg, Dcl1, Ocilrp2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WVF9 (0-121)
    • engineered mutation (0)
    • engineered mutation (63)
  Domains in SCOPe 2.04: d3rs1b_
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3rs1A (A:)
  mnktyaacsknwtgvgnkcfyfsgyprnwtfaqafcmaqeaqlarfdneeeliflkrfkg
  dfdswiglhressehpwkwtnnteynnmnpilgvgryaylssdrisssrsyinrmwicsk
  ln
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3rs1B (B:)
  mnktyaacsknwtgvgnkcfyfsgyprnwtfaqafcmaqeaqlarfdneeeliflkrfkg
  dfdswiglhressehpwkwtnnteynnmnpilgvgryaylssdrisssrsyinrmwicsk
  ln