PDB entry 3rs1
View 3rs1 on RCSB PDB site
Description: Mouse C-type lectin-related protein Clrg
Class: immune system
Keywords: C-type lectin-like, ligand of NK receptor, natural killer cell receptors, Surface of activated T lymphocytes, IMMUNE SYSTEM
Deposited on
2011-05-02, released
2012-05-02
The last revision prior to the SCOPe 2.04 freeze date was dated
2012-12-19, with a file datestamp of
2012-12-14.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.186
AEROSPACI score: 0.47
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: C-type lectin domain family 2 member I
Species: MUS MUSCULUS [TaxId:10090]
Gene: Clec2i, Clrg, Dcl1, Ocilrp2
Database cross-references and differences (RAF-indexed):
- Uniprot Q9WVF9 (0-121)
- engineered mutation (0)
- engineered mutation (63)
Domains in SCOPe 2.04: d3rs1a_ - Chain 'B':
Compound: C-type lectin domain family 2 member I
Species: MUS MUSCULUS [TaxId:10090]
Gene: Clec2i, Clrg, Dcl1, Ocilrp2
Database cross-references and differences (RAF-indexed):
- Uniprot Q9WVF9 (0-121)
- engineered mutation (0)
- engineered mutation (63)
Domains in SCOPe 2.04: d3rs1b_ - Heterogens: CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3rs1A (A:)
mnktyaacsknwtgvgnkcfyfsgyprnwtfaqafcmaqeaqlarfdneeeliflkrfkg
dfdswiglhressehpwkwtnnteynnmnpilgvgryaylssdrisssrsyinrmwicsk
ln
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3rs1B (B:)
mnktyaacsknwtgvgnkcfyfsgyprnwtfaqafcmaqeaqlarfdneeeliflkrfkg
dfdswiglhressehpwkwtnnteynnmnpilgvgryaylssdrisssrsyinrmwicsk
ln